PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c19_20750V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 355aa    MW: 38572.3 Da    PI: 6.0491
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c19_20750V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.1e-151461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+W ++Ed++lv +++ +G  +W++I++  g+ R++k+c++rw +yl
  Pp3c19_20750V3.2.p 14 RGPWAADEDKKLVSYINAHGVSCWRAIPKLAGLLRCGKSCRLRWTNYL 61
                        89******************************99************97 PP

2Myb_DNA-binding50.83.8e-1667112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg +T  E+ l++d+++ lG++ W++Ia  ++ gRt++++k++w+++l
  Pp3c19_20750V3.2.p  67 RGGFTDAEENLILDLHATLGNR-WSKIAMQLP-GRTDNEIKNYWNTHL 112
                         7889******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-22564IPR009057Homeodomain-like
PROSITE profilePS5129414.221961IPR017930Myb domain
SuperFamilySSF466892.49E-2711108IPR009057Homeodomain-like
SMARTSM007172.9E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-131461IPR001005SANT/Myb domain
CDDcd001678.56E-101661No hitNo description
PROSITE profilePS5129425.98962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2665116IPR009057Homeodomain-like
SMARTSM007173.6E-1666114IPR001005SANT/Myb domain
PfamPF002492.3E-1467112IPR001005SANT/Myb domain
CDDcd001671.16E-1270112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MGRKPCCEKV GLKRGPWAAD EDKKLVSYIN AHGVSCWRAI PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGGF TDAEENLILD LHATLGNRWS KIAMQLPGRT DNEIKNYWNT HLKKKLCSMG  120
LDPVTHKPVD SACTDGDTET ADEGNLDSSE GHSGHSKVME NSLASKVSDE LAQLKTIDYL  180
GERMDTQKPF PTTCNEIPEQ GAISGKSCSL DTTNSFKEHK PDVFVKLEEG TYTTGPDHMN  240
AIALENHTPL GPNSEGAADS CWLPQEQSLD TAVGGSSFYQ EVAVMNGGGL FRQLSGFTQS  300
NMATAGWSTY FGETPGQPSS TGCSISSWNQ SFVQPPGVPP SKEIQKLAAI LDQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.23910.0protonema
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S433_19V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.15e-72myb domain protein 40